Protein Info for BPHYT_RS04430 in Burkholderia phytofirmans PsJN

Annotation: amino acid ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF00005: ABC_tran" amino acids 17 to 170 (154 residues), 97.4 bits, see alignment E=1.7e-31 PF12399: BCA_ABC_TP_C" amino acids 220 to 244 (25 residues), 25.6 bits, see alignment (E = 1.1e-09)

Best Hits

KEGG orthology group: K01996, branched-chain amino acid transport system ATP-binding protein (inferred from 100% identity to bpy:Bphyt_0912)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivF (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0M9 at UniProt or InterPro

Protein Sequence (244 amino acids)

>BPHYT_RS04430 amino acid ABC transporter ATPase (Burkholderia phytofirmans PsJN)
MLSIRNLHAGYGKVKVLHGISIDVPKASVVTLIGSNGAGKTTTMRAISGMIRPSAGEITM
GVGTDAKRIDALDSHRIARLGLAHSPEGRRVFATMSVTDNLILGAFPRLTSARPRGDVKA
DLERAIEMFPRLKERRHQLAGTLSGGEQQMLAMARAIMMNPDLVLLDEPSMGLAPILVEE
VFRIIGNLKSQGVTMLLVEQFAAAALNVADYGYVLENGRIAAHGPATELRNDPSVKAAYL
GASH