Protein Info for BPHYT_RS04410 in Burkholderia phytofirmans PsJN
Annotation: heptose 1-phosphate adenyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K03272, D-beta-D-heptose 7-phosphate kinase / D-beta-D-heptose 1-phosphate adenosyltransferase [EC: 2.7.1.- 2.7.7.-] (inferred from 100% identity to bpy:Bphyt_0908)Predicted SEED Role
"ADP-heptose synthase (EC 2.7.-.-) / D-glycero-beta-D-manno-heptose 7-phosphate kinase" in subsystem LOS core oligosaccharide biosynthesis (EC 2.7.-.-)
MetaCyc Pathways
- ADP-L-glycero-β-D-manno-heptose biosynthesis (4/5 steps found)
KEGG Metabolic Maps
- Biosynthesis of siderophore group nonribosomal peptides
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
- Lipopolysaccharide biosynthesis
- Nicotinate and nicotinamide metabolism
- Nucleotide sugars metabolism
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 2.7.-.-, 2.7.1.-, 2.7.7.-
Use Curated BLAST to search for 2.7.-.- or 2.7.1.- or 2.7.7.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2T0M5 at UniProt or InterPro
Protein Sequence (319 amino acids)
>BPHYT_RS04410 heptose 1-phosphate adenyltransferase (Burkholderia phytofirmans PsJN) MTRNPPVKLSPPDFDCAQLMVVGDVMLDWYWHGSTSRISPEAPVPVVHVQAEETRVGGAG NVALNAAALGARVRLLGLAGQDAHADRIEELLREGGVDCVLQRVAGSKTITKLRILSRHQ QMIRADFEDHFPERNGDELIFSFERQLHEVDAVVLSDYAKGSLHDSKNLISAARRTGKPV IVDPKGTDFERYRGATVITPNLSEFEAVVGRCDSDATIEQKGAALCDAFEFEAALVTRSE KGMTLIARGHAPLHLPTRAREVFDVTGAGDTVVATLSAALGAGMPLDEAVVLSNVAAGIV VAKLGTATVRRPELQQALQ