Protein Info for BPHYT_RS04365 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 197 to 214 (18 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 260 to 284 (25 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 315 to 335 (21 residues), see Phobius details amino acids 341 to 359 (19 residues), see Phobius details amino acids 380 to 407 (28 residues), see Phobius details amino acids 420 to 438 (19 residues), see Phobius details amino acids 452 to 473 (22 residues), see Phobius details PF01040: UbiA" amino acids 207 to 438 (232 residues), 77.5 bits, see alignment E=1e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0898)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0L3 at UniProt or InterPro

Protein Sequence (474 amino acids)

>BPHYT_RS04365 membrane protein (Burkholderia phytofirmans PsJN)
MRSRPLVVDLDGTLIRSDILIESGFAYLKAAPQRFYEPLLWLARGGKPGLKARLADATNV
DVAVLPYDATVLQWLKVERDAGRSLVLATASHERYAQAISAHLGIFDRTFATNGSINLSA
HNKRDTLVAEYGEKGFDYAGNSHDDLAVWQSADRAYVVNPSNGVERAARKIGNVERVIES
RPPAVKTWAKSLRLHQWLKNLLIFLPLLAAHKLSSPELTLAAVLAFLTFGLCASSVYLLN
DLLDLEDDRHHPVKRKRPLASGALPLTWGLALFPVLLVVAFVTAWLFLPWQFSAALFGYY
VLTLAYSTFLKRQVMVDVVVLAMLYTMRIIAGTAAVDAQLTFWLLAFSMFIFLSLALVKR
YAELHSMKARGLVKTRGRGYVASDLSLISSLGTSSGYLAVLVLALYIQDAKTAGMYHHPQ
VIWLACPLLLYWVSRTWIIAHRGLMHDDPIVFAARDRVSLAVVVLCGLIFWAAI