Protein Info for BPHYT_RS04355 in Burkholderia phytofirmans PsJN

Annotation: short-chain dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 223 to 241 (19 residues), see Phobius details PF00106: adh_short" amino acids 2 to 190 (189 residues), 119.2 bits, see alignment E=2.4e-38 PF08659: KR" amino acids 4 to 167 (164 residues), 35.5 bits, see alignment E=1.4e-12 PF13561: adh_short_C2" amino acids 8 to 193 (186 residues), 88.5 bits, see alignment E=8.3e-29

Best Hits

Swiss-Prot: 39% identical to Y2073_MYCTU: Uncharacterized oxidoreductase Rv2073c (Rv2073c) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0896)

Predicted SEED Role

"Sorbitol-6-phosphate 2-dehydrogenase (EC 1.1.1.140)" in subsystem D-Sorbitol(D-Glucitol) and L-Sorbose Utilization (EC 1.1.1.140)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.140

Use Curated BLAST to search for 1.1.1.140

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0L1 at UniProt or InterPro

Protein Sequence (246 amino acids)

>BPHYT_RS04355 short-chain dehydrogenase (Burkholderia phytofirmans PsJN)
MKNILIVGATSAIAIACARQWATQGARFFLVARNGERLQQVAADLSARGAQLAACHQLDI
DRLDLHAGMLEQCQKELGALDIVLVAPGTLPDQAACQADPAVAVREFNTNAVSVIALLTP
IANILEAQKRGALAVISSVAGDRGRPSNYLYGSAKAALSAFCEGLNARLFKTGVHVLTIK
PGFVATPMTAGLPLPGPLVATPDQVASDIVRAVDKRKDVLYTRWFWAIIMLIIRSVPRFL
FKRASL