Protein Info for BPHYT_RS04350 in Burkholderia phytofirmans PsJN

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 571 transmembrane" amino acids 7 to 30 (24 residues), see Phobius details amino acids 86 to 106 (21 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 179 to 206 (28 residues), see Phobius details amino acids 217 to 234 (18 residues), see Phobius details amino acids 254 to 271 (18 residues), see Phobius details amino acids 277 to 297 (21 residues), see Phobius details amino acids 307 to 330 (24 residues), see Phobius details amino acids 336 to 357 (22 residues), see Phobius details amino acids 368 to 387 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0895)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0L0 at UniProt or InterPro

Protein Sequence (571 amino acids)

>BPHYT_RS04350 membrane protein (Burkholderia phytofirmans PsJN)
MSRRETLGNYAVLALGVITFATTVFAVWQHFSPLPYGDSWDGSIGFYMRAAQDPWHAFFE
QHNEHRLTFSRLIFFADIRYFGGRNVFSLISNLVLAGALAAAFFRITFHYRPTLSRQTRF
GLAGAILVFAFSWMQRENFAWGFQSQWFAVYLFALLAFHSIDRTAEANAGDKPAKRLGWL
AVALVSAWLAAYSMSSGVLVLPALIVQALYARLNPRQLLAIVIVTVAVWLAYFIDWHKPG
SSGNLLAGVREHPLAAIRYVLLYLGSPAFQIRTGLAGAYVAGILVLAALAANCFRLLRAS
ADRPQGVALLVFALFIAGNALLTASGRLWFGLETALASRYTTASLMGWLALILFAVLNSR
TPEQLRRAVFVAALATLAVASGQRFFVRADRDETYARFVAGLALRAHVYDAEIIRPVYPF
PDALPNIARQAEAEHLSIFAPDQPDYLVPPSQVNASLPCAGSIDDISATTTPGTYRATGW
IYDQADKRTPRAIVVTDATGTTLGTGVIGAERGDVRNIFGRSARYSGWTAFFKAPASGGI
RVDGQTAAGAYCALQAEKAMPAALPAAAAVQ