Protein Info for BPHYT_RS04330 in Burkholderia phytofirmans PsJN

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 34 to 49 (16 residues), see Phobius details amino acids 61 to 86 (26 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 138 to 167 (30 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 211 to 230 (20 residues), see Phobius details amino acids 242 to 260 (19 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details amino acids 326 to 349 (24 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0891)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0K6 at UniProt or InterPro

Protein Sequence (380 amino acids)

>BPHYT_RS04330 hypothetical protein (Burkholderia phytofirmans PsJN)
MHGRLTRGYLWAEDAPIFIKEGFELGARAIITPYAGYLHAVPRLLIYGYTWFGTVTSTPH
AFVWLTTSTTLVSCLYLYVIAARYLPRAGAYLLGLSPVLIPHNGEAWLTVTNLQWVLAPV
LIAMVWDCTQRTDTNRIFGRCVAIGLLSLTGPFSILFSPIAALGIVAHLKRSGRRLCSLP
LLVVVAGGAVQLATLLTSPPNHPAAHAASEYLHFGWLSAFFHYFVLDFLLADRWINGLGK
GMFYVSFALFAAVLACVATLPGKWRNACVIALALAVAFWMLGVVRSDAPELPVRWSGVSA
RYTFFPLILCMWTFVIAAAKSRIALARYGATLFLLLMLVNSALRFAAPWYPYEIVSTQAG
VFLVHAPPGDVFRAEVKPLR