Protein Info for BPHYT_RS04280 in Burkholderia phytofirmans PsJN

Annotation: dTDP-4-dehydrorhamnose reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 9 to 295 (287 residues), 357 bits, E=1.4e-110
• TIGR01214: dTDP-4-dehydrorhamnose reductase
  • amino acids 9 to 295 (287 residues), 328.1 bits, E=1.9e-102
• PF01370: Epimerase
  • amino acids 10 to 165 (156 residues), 75.6 bits, E=8.6e-25
• PF16363: GDP_Man_Dehyd
  • amino acids 40 to 143 (104 residues), 42.5 bits, E=1.2e-14
• PF07993: NAD_binding_4
  • amino acids 59 to 160 (102 residues), 21 bits, E=3.4e-08

Best Hits

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 100% identity to bpy:Bphyt_0881)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)

KEGG Metabolic Maps

• Polyketide sugar unit biosynthesis
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.133

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

See B2T0J6 at UniProt or InterPro

Protein Sequence (298 amino acids)

>BPHYT_RS04280 dTDP-4-dehydrorhamnose reductase (Burkholderia phytofirmans PsJN)
MSAHDAKRTILVTGVNGQVGFELARTLQGLGTMVAVDHAAMDLSDPDQVRAVVRNIRPTL
IVNPAAYTAVDKAEEELDLAMRINGEVPGVLAEEAKKLGAALVHYSTDYVFNGEKDGAYV
EDDPTDPQNAYGRTKLAGEQAIAASGCDHLIFRTSWVYGTRGKNFLLTMLRLGAERDELS
VVADQIGAPTWSKTIATLTANVLAQAAAPGQGDWWQQRSGVYHLTAAGSASWHGFAEAIF
ELSGLAKTPTVKPIPAASYPTPAKRPGNSRMSNDKLARTFGVQAPDWRDALQLCLGER