Protein Info for BPHYT_RS04220 in Burkholderia phytofirmans PsJN
Annotation: hypothetical protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to Y0649_PARXL: UPF0301 protein Bxeno_A0649 (Bxeno_A0649) from Paraburkholderia xenovorans (strain LB400)
KEGG orthology group: K07735, putative transcriptional regulator (inferred from 100% identity to bxe:Bxe_A3811)Predicted SEED Role
"UPF0301 protein YqgE"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See B2T0I4 at UniProt or InterPro
Protein Sequence (192 amino acids)
>BPHYT_RS04220 hypothetical protein (Burkholderia phytofirmans PsJN) MSKSTDRINLTNQFLIAMPNMADPTFSGTVVYLCDHSERGALGLVINRPTDIDLQALFSR IDLKLEIEPLLHVPVYFGGPVQTERGFVLHDPKDGNAYTSSMSVPGGLEMTTSKDVLEAV ASGTGPERFLLTLGHAGWGAGQLEEEISKNGWLTVEADPKIVFDVPAEERLEAALALLGI NLSMLSGEAGHA