Protein Info for BPHYT_RS04195 in Burkholderia phytofirmans PsJN

Annotation: molecular chaperone GroES

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00166: Cpn10
  • amino acids 2 to 94 (93 residues), 123.6 bits, E=1.4e-40

Best Hits

Swiss-Prot: 100% identical to CH10_PARPJ: 10 kDa chaperonin (groS) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K04078, chaperonin GroES (inferred from 94% identity to bgl:bglu_1g07140)

MetaCyc: 53% identical to cochaperonin GroES (Escherichia coli K-12 substr. MG1655)
Non-chaperonin molecular chaperone ATPase. [EC: 3.6.4.10, 5.6.1.7]

Predicted SEED Role

"Heat shock protein 60 family co-chaperone GroES" in subsystem GroEL GroES

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.4.10 or 5.6.1.7

Sequence Analysis Tools

See B2T0H9 at UniProt or InterPro

Protein Sequence (96 amino acids)

>BPHYT_RS04195 molecular chaperone GroES (Burkholderia phytofirmans PsJN)
MNLRPLHDRVIVKRLDQETKTASGIVIPEAAAEKPDQGEILAVGPGKRDDKGAQIALDVK
VGDRVLFGKYAGQTVKVDGNELLVMREEDIMAVVQK