Protein Info for BPHYT_RS04150 in Burkholderia phytofirmans PsJN

Annotation: UDP-galactopyranose mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details TIGR00031: UDP-galactopyranose mutase" amino acids 2 to 361 (360 residues), 383.2 bits, see alignment E=6.5e-119 PF01494: FAD_binding_3" amino acids 3 to 35 (33 residues), 22 bits, see alignment 3.9e-08 PF00890: FAD_binding_2" amino acids 4 to 41 (38 residues), 27.5 bits, see alignment 8.5e-10 PF01266: DAO" amino acids 4 to 56 (53 residues), 28.7 bits, see alignment 4.4e-10 PF03486: HI0933_like" amino acids 4 to 38 (35 residues), 24 bits, see alignment 7e-09 PF13450: NAD_binding_8" amino acids 7 to 72 (66 residues), 71.7 bits, see alignment E=2.2e-23 PF01593: Amino_oxidase" amino acids 12 to 81 (70 residues), 30.4 bits, see alignment E=1.2e-10 PF03275: GLF" amino acids 147 to 344 (198 residues), 261.8 bits, see alignment E=2e-81

Best Hits

KEGG orthology group: K01854, UDP-galactopyranose mutase [EC: 5.4.99.9] (inferred from 100% identity to bpy:Bphyt_0851)

Predicted SEED Role

"UDP-galactopyranose mutase (EC 5.4.99.9)" in subsystem LOS core oligosaccharide biosynthesis or linker unit-arabinogalactan synthesis (EC 5.4.99.9)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.99.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0G8 at UniProt or InterPro

Protein Sequence (363 amino acids)

>BPHYT_RS04150 UDP-galactopyranose mutase (Burkholderia phytofirmans PsJN)
MKYDALIVGAGFAGTVCAERLASAGKRVLVIDKRNHIGGNAFDCYDENGVLIHPYGPHIF
HTSGKRIFEYLSNFTDWRLYEHRVLAHLDGEFYPIPINRTTINKLYGLDLNEEGVKAYLE
SVREARNDIATSEDVVLSSVGSDLCDKFFRGYTQKQWGLDLADLSAGVAARIPTRSNDDD
RYFTDTYQFMPARGYTAMFEKMLGHPNIEVRLSEDFRVLRSVVEREHTVYTGPIDAFFDY
RFGKLPYRSLSFQHEHLTDVDQFQQTGTINYPNDHEYTRITEFKHLTGQQHSGTSIVREY
PRAEGDPYYPIPRSENEALFKRYHELAEATPDVTFVGRLAQYRYYNMDQVVGAALKVAEE
LAQ