Protein Info for BPHYT_RS04095 in Burkholderia phytofirmans PsJN

Annotation: SAM-dependent methyltransferase PhcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 272 PF01209: Ubie_methyltran" amino acids 36 to 150 (115 residues), 54.9 bits, see alignment E=2.4e-18 PF13489: Methyltransf_23" amino acids 36 to 148 (113 residues), 29.6 bits, see alignment E=1.6e-10 PF13847: Methyltransf_31" amino acids 44 to 147 (104 residues), 40 bits, see alignment E=1.1e-13 PF13649: Methyltransf_25" amino acids 46 to 139 (94 residues), 69.9 bits, see alignment E=7.7e-23 PF08241: Methyltransf_11" amino acids 47 to 143 (97 residues), 74.5 bits, see alignment E=2.7e-24 PF08242: Methyltransf_12" amino acids 47 to 141 (95 residues), 41.9 bits, see alignment E=4.3e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0840)

Predicted SEED Role

"Methyltransferase type 11"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0F7 at UniProt or InterPro

Protein Sequence (272 amino acids)

>BPHYT_RS04095 SAM-dependent methyltransferase PhcB (Burkholderia phytofirmans PsJN)
MNSFGTDTRFTGSIAELYESHLVPMLFEPYAADLANRVDRRQPSRVLETAAGTGVVTRPM
AHALPMHVELVATDLNQPMLDRAAAIGTSRPVRWQQADATRLPFDDASFDVVVCQFGAMF
FPDKAHAFAEARRVLRRDGALLFNVWDRIEENEFANTVTATLAGLFPADPPLFLARTPYG
YFDPAIISRDLVNAGFSAAPRFETIAARSRAASALVPAVGLCQGTPLRSEIEARSGGAVD
DATSACATAIAERFGTGPVDGKIQAHVVMVQS