Protein Info for BPHYT_RS04090 in Burkholderia phytofirmans PsJN

Annotation: CBS domain containing membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 36 to 55 (20 residues), see Phobius details amino acids 62 to 82 (21 residues), see Phobius details amino acids 88 to 106 (19 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 136 to 153 (18 residues), see Phobius details PF04982: HPP" amino acids 39 to 159 (121 residues), 134.2 bits, see alignment E=2.8e-43 PF00571: CBS" amino acids 226 to 277 (52 residues), 44.5 bits, see alignment 1.6e-15 amino acids 305 to 357 (53 residues), 39.3 bits, see alignment 6.8e-14

Best Hits

KEGG orthology group: K07168, CBS domain-containing membrane protein (inferred from 100% identity to bpy:Bphyt_0839)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0F6 at UniProt or InterPro

Protein Sequence (371 amino acids)

>BPHYT_RS04090 CBS domain containing membrane protein (Burkholderia phytofirmans PsJN)
MAVRWPERLRSCVGALLGIAFTGGTMHVLLGPAANIPLLVAPMGASAVLLFAVPASPLAQ
PWSIIGGNIVSATVGVACASWIGDPVGAAALAVALAICAMFALRCVHPPSGAVALTAVLG
GPAVHALGYRFVAEPIAIQSVTLLCAAIVYHAATGHRYPHVAQASSLKGAGASASASSEG
FTRADLEAVLNRRGELLDIDTDDLESLLRDVQLQAYARTFNELTCADIMSRSLVAVSATT
RASAAWSLLKQRHIKALPVTDEKQHVIGIVTRADLVDKRAFGKAPGQTSPMKRWFRRSVT
PAPLVGALMNVDVQTVEGTTPIVELVPVFANYGHHHIPVLDSQQRLAGMITQADLIAGLY
RQAYARQRTAA