Protein Info for BPHYT_RS04080 in Burkholderia phytofirmans PsJN

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 120 to 131 (12 residues), see Phobius details amino acids 163 to 187 (25 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 232 to 257 (26 residues), see Phobius details amino acids 269 to 287 (19 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 334 to 354 (21 residues), see Phobius details amino acids 361 to 388 (28 residues), see Phobius details amino acids 394 to 413 (20 residues), see Phobius details PF00654: Voltage_CLC" amino acids 76 to 409 (334 residues), 263.4 bits, see alignment E=3.2e-82 PF00571: CBS" amino acids 443 to 491 (49 residues), 29 bits, see alignment 1.1e-10 amino acids 516 to 565 (50 residues), 22 bits, see alignment 1.7e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0837)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0F0 at UniProt or InterPro

Protein Sequence (596 amino acids)

>BPHYT_RS04080 chloride channel protein (Burkholderia phytofirmans PsJN)
MSFDTHKRDFSVNARLPGISALAAGIGALSTLAAFVLLSLIHLFTNLFFFQQFSFADRSP
AVNTLGVWVVVIPVIGGLIVGLMARYGSEKIRGHGIPEAIEAILFGKSRMSPKVAILKPL
SSGIVIGSGGPFGAEGPIIMTGGALGSLIAQCVKVTAAERKTLLVAGAAAGMTAVFGTPV
AAVLLAVELLLFEWRPRSFLPVALACAVAGFARAAFFGTGPLFPLETAPPGALSLLSCVV
AGLLSGALASGLSAALYKVEDLFGKLPIHWMWWPALGGLVVGIGGFLEPRALGVGYDVIG
DLLHQHIAIQIALAILIVKAVIWVVALGSGTSGGVLAPLLMLGAGLGVLLGHVLPGGEPA
LWPLVCMAATLGATLGAPLTAIVFAFGLTHDSNALLPLLAATLIAHGFATVVMKRSIMTE
KIARRGYHIYREYGVDPLERHHVDEVMSRTVKTIDGDMSVAEALATYFGATQTHRAYPVV
RQGALVGVVDRAVLEAIRDDETHNTLDSRLADILRHRSPTFALPGETCRLVATRLAVHGL
ERLPVVADSTTLQLIGIVSRSDLIKPSLAHFDEEHKKERFRRLRMHTGKRHFPPVP