Protein Info for BPHYT_RS04045 in Burkholderia phytofirmans PsJN

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 20 to 38 (19 residues), see Phobius details amino acids 58 to 76 (19 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 165 to 189 (25 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 284 to 305 (22 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 17 to 342 (326 residues), 97.5 bits, see alignment E=4.3e-32

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0830)

Predicted SEED Role

"Lysophospholipid acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0E7 at UniProt or InterPro

Protein Sequence (384 amino acids)

>BPHYT_RS04045 acyltransferase (Burkholderia phytofirmans PsJN)
MKLFGGAGPAKAGRAIELDFVRGIAIIMVMGFHFHAVHTGNYLIQIIEYPLKSFGREGVN
LFFTLSGFLVGGLLLRQYAETGHVDARRFIIRRIFRIWPAYYVLIAFHVLAGRHPWNSFL
VQNLTHLQNYLGTSITQTWSLAVEEHFYLVLPALLLIFSRWRLGAWTIVGILTGICAVVL
TARCFAVAGGNLDGAFAYTQYRIDSLLVGVILSAIYWMKPGVYHQLAKRKWLLIFSVLLL
CAWLAFATKNLVLDESIGYTIQALGFAALIVLVLEYSGSLRTSWIYRGVAWIGLYSYGIY
LWHSLALAPGDMLIRKATALGLAPSLIWVVALAAQFAIAIAIGYVTTRAIEYPFLLMRNA
LFPEKRSSSVREEVPAAAAGGQLS