Protein Info for BPHYT_RS04035 in Burkholderia phytofirmans PsJN

Annotation: transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF13579: Glyco_trans_4_4" amino acids 15 to 178 (164 residues), 71.6 bits, see alignment E=2.5e-23 PF13439: Glyco_transf_4" amino acids 15 to 176 (162 residues), 53.5 bits, see alignment E=7.7e-18 PF20706: GT4-conflict" amino acids 196 to 323 (128 residues), 48.4 bits, see alignment E=1.8e-16 PF00534: Glycos_transf_1" amino acids 199 to 359 (161 residues), 100.5 bits, see alignment E=2.1e-32 PF13692: Glyco_trans_1_4" amino acids 204 to 341 (138 residues), 80.8 bits, see alignment E=3.1e-26

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0828)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0E5 at UniProt or InterPro

Protein Sequence (406 amino acids)

>BPHYT_RS04035 transferase (Burkholderia phytofirmans PsJN)
MKILHLLASVDPRAGGPVEGVRRSGLAMREAGHEIEVATCDAPRDAYLASFPFPIHVFGP
TKGRYSFSERLAPWLAANAKRFDAVIVHGLWQYHGFAAWKALHGSEVPYYVYVHGMLDPW
FKEAYPLKHLKKWLYWPWAEYRVLRDARAVIFTTEEERTRARKSFWLYRAHERIVPFGTT
VPQLEAAPLREAFLQAIPSLRGKRIVLFLGRVHAKKGCDLLIDAFARVASRDPTLHLVIA
GPDETGWASTLRSQAQAAGIAHRVSLPGMLQGELKWGAFHASDVFVLPSHQENFGVAVAE
ALGCGLPALISDKVNVWREIEADGAGMVAADTIDGTEKNLLRWLELDDAARAAMRAQAAE
TFNARFRVETMVSALTALLETRGAHDDARNSDNTLTTLRETTQPTH