Protein Info for BPHYT_RS03955 in Burkholderia phytofirmans PsJN

Annotation: glycosyl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 PF13439: Glyco_transf_4" amino acids 13 to 168 (156 residues), 62.5 bits, see alignment E=1.3e-20 PF13579: Glyco_trans_4_4" amino acids 14 to 164 (151 residues), 45.7 bits, see alignment E=2.3e-15 PF20706: GT4-conflict" amino acids 124 to 293 (170 residues), 32 bits, see alignment E=1.7e-11 PF00534: Glycos_transf_1" amino acids 184 to 335 (152 residues), 68.9 bits, see alignment E=9.9e-23 PF13692: Glyco_trans_1_4" amino acids 186 to 326 (141 residues), 72.7 bits, see alignment E=9.9e-24

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0811)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0C8 at UniProt or InterPro

Protein Sequence (361 amino acids)

>BPHYT_RS03955 glycosyl transferase (Burkholderia phytofirmans PsJN)
MRILQLVHAPRLSGAEVLVKGLAIHHQRGGHEVCMTSLLPEQEDFAAIHAELQAAGVTCL
FPEVRYGRVGKLLHLYRVVRRFRPDFIVAHATLAALYVRLLPVHTPIAWVMHSGVNDFEN
GALKRAERLLSRRARAIIGVSQQNIDDYLREIGRHPAMVVIPNGVDAQLFSQANDAVAPD
IGVHPKQIVQLGRYIEGKSQLDTIRAFERVLQSEPEARLLFCGVVEDLDYHRAVLSLVRQ
LGLENRVTVGGPRSDVAAILRASRVFAMPSRFEAQSIGFLEALASGIPVVASRIPSFGFA
SAFAGVSLVDTTDAEAYGRALLHALDTPRANRQLAGYTLHDTADRYMTIAQKFVHPLQVS
A