Protein Info for BPHYT_RS03835 in Burkholderia phytofirmans PsJN

Annotation: D-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00389: 2-Hacid_dh
  • amino acids 5 to 328 (324 residues), 114.4 bits, E=4.9e-37
• PF02826: 2-Hacid_dh_C
  • amino acids 110 to 298 (189 residues), 184.1 bits, E=2.5e-58
• PF03446: NAD_binding_2
  • amino acids 146 to 257 (112 residues), 21.2 bits, E=3.8e-08

Best Hits

Swiss-Prot: 52% identical to DDH_HAEIN: 2-hydroxyacid dehydrogenase homolog (ddh) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03778, D-lactate dehydrogenase [EC: 1.1.1.28] (inferred from 100% identity to bpy:Bphyt_0787)

MetaCyc: 52% identical to D-lactate dehydrogenase (Escherichia coli K-12 substr. MG1655)
D-lactate dehydrogenase. [EC: 1.1.1.28]

Predicted SEED Role

"D-lactate dehydrogenase (EC 1.1.1.28)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.28)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• heterolactic fermentation (16/18 steps found)
• mixed acid fermentation (13/16 steps found)
• L-alanine degradation II (to D-lactate) (3/3 steps found)
• pyruvate fermentation to (R)-lactate (1/1 steps found)
• vancomycin resistance I (2/3 steps found)
• L-alanine degradation VI (reductive Stickland reaction) (4/6 steps found)
• superpathway of L-alanine fermentation (Stickland reaction) (6/9 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (5/9 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (4/8 steps found)

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.28

Use Curated BLAST to search for 1.1.1.28

Sequence Analysis Tools

See B2T0A5 at UniProt or InterPro

Protein Sequence (332 amino acids)

>BPHYT_RS03835 D-lactate dehydrogenase (Burkholderia phytofirmans PsJN)
MRMILFSSRQYDRDTFTEANATHRYELHCQESHLDSETAILAQGYDVVCPFVNDNVDAAV
LARLHAGGTRMIALRSAGFNHVDLAAAERLGITVARVPAYSPHAVAEHAVGLILALNRRL
PRAVARTREGDFSLHGLLGFDLHGKTVGVIGTGMIGRVFGRIMAGFGMQVLAYDPGKPAA
DLLALGARYVPLDALLAESDVVSLHCPLVPDTYHLINGPALAKMKRGAMLINTGRGGLVE
SNALIGALKDGQLGHLGLDVYEEESGLFFEDHSNLPLQDDVLARLLMFPNVIVTAHQAFF
TREAMNEIAQTTLDNVAAWQAGTPRNVVRAPA