Protein Info for BPHYT_RS03815 in Burkholderia phytofirmans PsJN

Annotation: MFS transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 43 to 65 (23 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 268 to 288 (21 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details amino acids 357 to 375 (19 residues), see Phobius details PF12832: MFS_1_like" amino acids 2 to 139 (138 residues), 30.4 bits, see alignment E=2.2e-11 PF07690: MFS_1" amino acids 12 to 247 (236 residues), 84.7 bits, see alignment E=6.3e-28 amino acids 206 to 382 (177 residues), 50.6 bits, see alignment E=1.4e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0783)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T0A1 at UniProt or InterPro

Protein Sequence (386 amino acids)

>BPHYT_RS03815 MFS transporter permease (Burkholderia phytofirmans PsJN)
MKVIFTRDFLALILSVAVVGLGSGATLPLTALALTQAGYGTDVVGLLTAAQAGGGLVIVP
LAGWITARFGGRQVIVGAVLVVAFATALMQLTSNLWLWAVLRVLCGAALMLLFTIGEAWV
NQLADDATRGRVIAIYATNFTLFQMAGPVLVSQIAGFAQWRFLICGAIFLLALPMLATIR
KTPQASEDEHSAHGSWRRVLPQMPALVIGTGFFALFDTIALSLLPLFAMSHGMTSEVAVL
FASALLLGDTTMQFPIGWLADRLGRERVHIGCGVVVVALLPLLPWAIASPWLCWPLLYVL
GAAAGAIYTLSLVACGERFRGVALVSASSLVGASWSAASFGGPLVAGALMKGVGNDAMVG
VLLVAALAFLAAVWWERRRAPVRVAG