Protein Info for BPHYT_RS03725 in Burkholderia phytofirmans PsJN

Annotation: serine hydroxymethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00464: SHMT
  • amino acids 10 to 384 (375 residues), 572.1 bits, E=9.8e-176
• PF00155: Aminotran_1_2
  • amino acids 81 to 344 (264 residues), 41.3 bits, E=2.3e-14
• PF01212: Beta_elim_lyase
  • amino acids 81 to 342 (262 residues), 32 bits, E=1.6e-11
• PF00266: Aminotran_5
  • amino acids 82 to 252 (171 residues), 24.7 bits, E=2.3e-09

Best Hits

Swiss-Prot: 95% identical to GLYA3_BURL3: Serine hydroxymethyltransferase 3 (glyA3) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K00600, glycine hydroxymethyltransferase [EC: 2.1.2.1] (inferred from 100% identity to bpy:Bphyt_0765)

MetaCyc: 65% identical to serine hydroxymethyltransferase (Escherichia coli K-12 substr. MG1655)
4.1.2.-; Glycine hydroxymethyltransferase. [EC: 2.1.2.1]; RXN-6321 [EC: 2.1.2.1]; RXN0-5240 [EC: 2.1.2.1]

Predicted SEED Role

"Serine hydroxymethyltransferase (EC 2.1.2.1)" in subsystem Folate Biosynthesis or Glycine Biosynthesis or Glycine and Serine Utilization or LMPTP YwlE cluster or Photorespiration (oxidative C2 cycle) or Serine-glyoxylate cycle or Serine Biosynthesis (EC 2.1.2.1)

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• folate transformations II (plants) (9/11 steps found)
• glycine betaine degradation III (6/7 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• folate polyglutamylation (4/5 steps found)
• glycine biosynthesis I (1/1 steps found)
• glycine betaine degradation I (6/8 steps found)
• glycine degradation (2/3 steps found)
• formaldehyde assimilation I (serine pathway) (9/13 steps found)
• photorespiration I (6/9 steps found)
• photorespiration III (6/9 steps found)
• photorespiration II (6/10 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• folate transformations I (8/13 steps found)
• glycine betaine degradation II (mammalian) (1/4 steps found)

KEGG Metabolic Maps

• Cyanoamino acid metabolism
• Glycine, serine and threonine metabolism
• Methane metabolism
• One carbon pool by folate

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.1

Use Curated BLAST to search for 2.1.2.1

Sequence Analysis Tools

See B2T083 at UniProt or InterPro

Protein Sequence (415 amino acids)

>BPHYT_RS03725 serine hydroxymethyltransferase (Burkholderia phytofirmans PsJN)
MFDRAQSTIANVDPELWKVIEQENRRQEEHIELIASENYTSPAVMAAQGSQLTNKYAEGY
PGKRYYGGCEYVDVAEQLAIDRVKQLFGAEAANVQPNSGSQANQGVFFAMLKPGDTIMGM
SLAHGGHLTHGSPVNMSGKWFNVVSYGLNEAEDIDYDAAEKLAQEHKPKLIVAGASAFSL
RIDFERMSKIAKSVGAYFMVDMAHYAGLIAAGVYPNPVPHADFVTTTTHKSLRGPRGGVI
LMKAEFEKQINSAIFPGIQGGPLMHVIAGKAVAFKEALSPEFKAYQQQVVENARVLAETL
VKRGLRIVSGRTESHVMLVDLRAKKITGKAAEAALGAAHITVNKNAIPNDPEKPFVTSGV
RLGSPAMTTRGFGVKEAEQVGNLIADVLDNPEDAATIERVRGQVAELTQRFPVYR