Protein Info for BPHYT_RS03695 in Burkholderia phytofirmans PsJN

Annotation: protein TolB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 19 to 426 (408 residues), 491.8 bits, see alignment E=8.4e-152 PF04052: TolB_N" amino acids 28 to 127 (100 residues), 94.4 bits, see alignment E=8.9e-31 PF07676: PD40" amino acids 192 to 220 (29 residues), 28.9 bits, see alignment (E = 1.7e-10) amino acids 237 to 267 (31 residues), 34.6 bits, see alignment (E = 2.8e-12) amino acids 276 to 312 (37 residues), 51.8 bits, see alignment 1.1e-17 amino acids 324 to 359 (36 residues), 39.7 bits, see alignment 6.7e-14 amino acids 369 to 396 (28 residues), 13.4 bits, see alignment (E = 1.3e-05)

Best Hits

Swiss-Prot: 100% identical to TOLB_PARPJ: Tol-Pal system protein TolB (tolB) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K03641, TolB protein (inferred from 100% identity to bpy:Bphyt_0759)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T077 at UniProt or InterPro

Protein Sequence (430 amino acids)

>BPHYT_RS03695 protein TolB (Burkholderia phytofirmans PsJN)
MSLMTKLGLRTLVASCLIAVGGAAHAQLNVLVTGVGSTQFPIATANFANEANSPQQVSTI
VRQDLQRSGKFTNIDAGSTPVAETDSVDLGSWKAKGANAFVSGSVNRLPNGQYEVRFKLY
DTVKGESLGGLVLVSPESGLRMSAHKVADYIYAKLMGGRGVFATRLSYVIKTGGRYQLQI
SDSDGQDAHIALSSPEPIISPAWSPDGTKVAYVSFEKKKPIVYIHDLPTGRRVVVSDQKG
NNSAPAWSPDGRTLAVALSRTGNTQIFAVNADGSGLRRLTQGSSIDTEPCFSPDGQSIYF
TSDRGGQPQIYKMSAQGENAGAAQRVTFTGSYNTSPRVSPDGKQLAYISRVGGGFKLYIQ
DLQGNTATGLTDTTHDESPSFAANGQYILYATQVNGRGVLAAVSTDGRTRQVLSVQGGSV
REPSWGPFMQ