Protein Info for BPHYT_RS03685 in Burkholderia phytofirmans PsJN

Annotation: Tol system periplasmic component YbgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF16331: TolA_bind_tri" amino acids 43 to 115 (73 residues), 63 bits, see alignment E=9.5e-21 PF13512: TPR_18" amino acids 127 to 201 (75 residues), 26.3 bits, see alignment E=3.4e-09 TIGR02795: tol-pal system protein YbgF" amino acids 128 to 245 (118 residues), 126.2 bits, see alignment E=5.1e-41 PF13525: YfiO" amino acids 129 to 249 (121 residues), 43.8 bits, see alignment E=1.2e-14 PF13174: TPR_6" amino acids 132 to 161 (30 residues), 18.4 bits, see alignment 1.2e-06 amino acids 167 to 197 (31 residues), 19.1 bits, see alignment 6.8e-07 amino acids 203 to 235 (33 residues), 25.3 bits, see alignment 7.3e-09 PF13432: TPR_16" amino acids 134 to 198 (65 residues), 36.8 bits, see alignment E=2e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0757)

Predicted SEED Role

"TPR repeat containing exported protein; Putative periplasmic protein contains a protein prenylyltransferase domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T075 at UniProt or InterPro

Protein Sequence (249 amino acids)

>BPHYT_RS03685 Tol system periplasmic component YbgF (Burkholderia phytofirmans PsJN)
MTHRFSWLRFAAAACVAGTAFAAVPAHAGIFDDDQARQAILDLRSKTDSLSSQLSAAQRT
ILDQSNRLDQLNQQVATLRGQNEDMANQLATVQKQQKDYYTDLDTRLKKFEPQQQTVDGV
QGEVQPGETDSFNAASQQFRNGDFKNAAASFRTFIAKFPNSPYQPTAQYWLGNALYALRD
YKGSTATWQGVVQKYPQHPRAPEALLAIANNQLEQGQKAAAKKTLEQIVAQYGGSDVAQS
AQSKLSQIK