Protein Info for BPHYT_RS03660 in Burkholderia phytofirmans PsJN

Annotation: mechanosensitive ion channel protein MscS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 57 to 81 (25 residues), see Phobius details amino acids 87 to 114 (28 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 105 to 170 (66 residues), 62.7 bits, see alignment E=2.8e-21 PF21082: MS_channel_3rd" amino acids 178 to 256 (79 residues), 24.8 bits, see alignment E=2.4e-09

Best Hits

KEGG orthology group: K03442, small conductance mechanosensitive channel (inferred from 100% identity to bpy:Bphyt_0752)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T071 at UniProt or InterPro

Protein Sequence (270 amino acids)

>BPHYT_RS03660 mechanosensitive ion channel protein MscS (Burkholderia phytofirmans PsJN)
MDLETVRVFIMTRGIDLGTKVVGAIVLWIVGRWLIGLITGLLRKVLARNGRVDPTLAHYL
GSILGALLNLLLILAILQVFGVQTTSFAALLAGLGLAIGTAWGGLLAHFAAGVFMQVLRP
FKVGDFVTAGGVTGTVSELGLFGTTIVTPDNVTTIVGNNKIFSDTISNYSILPVRRVELT
AKIANGVDPTDAMNRLKAAVTQIPNVAESPAPDIEVLTFTPEGPLLCVRPYTNNEHYWQV
YFDTNRAIIQTFKEAGYPTPETPLAPRAVT