Protein Info for BPHYT_RS03650 in Burkholderia phytofirmans PsJN

Annotation: DNA mismatch repair protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 687 TIGR00585: DNA mismatch repair protein MutL" amino acids 29 to 329 (301 residues), 298.6 bits, see alignment E=3.6e-93 PF02518: HATPase_c" amino acids 48 to 102 (55 residues), 30 bits, see alignment 1.2e-10 PF13589: HATPase_c_3" amino acids 51 to 152 (102 residues), 50 bits, see alignment E=6.5e-17 PF01119: DNA_mis_repair" amino acids 232 to 348 (117 residues), 133.5 bits, see alignment E=6e-43 PF08676: MutL_C" amino acids 501 to 643 (143 residues), 156.1 bits, see alignment E=1e-49

Best Hits

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 100% identity to bpy:Bphyt_0750)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T069 at UniProt or InterPro

Protein Sequence (687 amino acids)

>BPHYT_RS03650 DNA mismatch repair protein (Burkholderia phytofirmans PsJN)
MSEFSETPAGLDAATAVSAAAPAPRPLRAIQPLPDQLISQIAAGEVVERPASVVKELLEN
ALDAGARSLRILLDEGGVKRISITDDGCGIPENELVLALMRHATSKIRSLAELEAVATLG
FRGEALASIASVAQMTITSRTADAAHAVRVDADTGVLSPAAGTQGTTIEVRELYFNTPAR
RKFLKSEQTELGHCLEQIRRAALARPDVAISVLHNGKAIEHWNASEPPVRVAKILGETFA
TAHLPLDESAGPLAVYGCAGLPTASRGRADQQYFFVNGRFVRDKLLTHAVRAAYEDVLHG
ERYPSYVLFLDLPPEAVDVNVHPSKIEVRFRDSRSIHQFVFHAVQRALARHAGASPETTA
GGHAAHLEPTAGGPASFGATPLDGAGIGGGAFGAGNGAGGFGGGSGGTSGGGFGSSQPGQ
PGNTWMRQARMTQGTLPVAQPLAFYDALFGRKDTNTGTAEGATLFEARDSAAESPSPYNA
SAPYPAPAFHAADDQPLGFALGQIHGIYVLAQNAHGLVIVDMHAAHERILYEQFKNALAD
RTIAVQPLLIPQSMQADPIEIGTVEEERDTLDALGFDLAVLSPTTLAIRAVPALLKDADL
QALARAVLSDLHAYGGSRVLTERQHEMLGTLACHHAVRANRRLTLDEMNALLRQMEATER
ADQCNHGRPTWYQLTLSDLDRLFMRGQ