Protein Info for BPHYT_RS03635 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 39 to 57 (19 residues), see Phobius details amino acids 65 to 89 (25 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 243 to 269 (27 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 311 to 341 (31 residues), see Phobius details PF01594: AI-2E_transport" amino acids 17 to 346 (330 residues), 194.1 bits, see alignment E=1.8e-61

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0747)

Predicted SEED Role

"Putative permease often clustered with de novo purine synthesis" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T066 at UniProt or InterPro

Protein Sequence (358 amino acids)

>BPHYT_RS03635 ABC transporter permease (Burkholderia phytofirmans PsJN)
MQENSTILTPVQRRAFIWLAIALGVGILLWLLSPVLTPFLLGAILAYILQPGVAWMVRRR
VPRGLAALLMMLLFTLVMTLLVLLVLAVIQKEAPQLKQQVPVFFAHVNAWLQPKLAMLGL
ADSLDFASIRDLVMGQLEGSAQTVAVYAWTYIRTSGNVMVTVVGNVVLVPLVLFYLLYDW
NRMLARAQVVVPRRWLDKTLQLARDMDQMLSQYLRGQLLVMGVLAVFYAVALTIARFEIA
LPVGIFTGLAVFIPYIGFATGLALALLAALLQFGDWYGFGAVAVIYGVGQILESFYLTPR
LVGERIGLHPLAVIFALLAFGQLFGFFGVLLALPVSAILSVAVRELRQSYLTSTLYNN