Protein Info for BPHYT_RS03625 in Burkholderia phytofirmans PsJN

Updated annotation (from data): Histidinol-phosphatase (EC:3.1.3.15)
Rationale: Auxotrophic, and rescued by histidne. It is usually annotated as phosphoserine phosphatase but that does not match its phenotypes and there is another putative serB. The only homolog of the traditional hisB phosphatase part is the essential protein BPHYT_RS03340, which seems more likely to be ghmB for cell wall synthesis. (auxotroph)
Original annotation: phosphoserine phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB
  • amino acids 4 to 198 (195 residues), 78.5 bits, E=6.1e-26
• TIGR01490: HAD hydrolase, family IB
  • amino acids 4 to 208 (205 residues), 125.9 bits, E=2.5e-40
• PF12710: HAD
  • amino acids 5 to 196 (192 residues), 127.8 bits, E=3.6e-41

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0745)

Predicted SEED Role

"Phosphoserine phosphatase (EC 3.1.3.3)" in subsystem Glycine and Serine Utilization or Serine Biosynthesis (EC 3.1.3.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• superpathway of L-serine and glycine biosynthesis I (4/4 steps found)
• L-serine biosynthesis I (3/3 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Glycine, serine and threonine metabolism
• Histidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.15, 3.1.3.3

Use Curated BLAST to search for 3.1.3.15 or 3.1.3.3

Sequence Analysis Tools

See B2T064 at UniProt or InterPro

Protein Sequence (228 amino acids)

>BPHYT_RS03625 Histidinol-phosphatase (EC:3.1.3.15) (Burkholderia phytofirmans PsJN)
MANLALFDLDHTLIPTDSDHEWGRFMVKHGMVDAENFARENDRFFADYKAGKLDIHAYLI
AMLTPLSKYTRAQLADFHAQYMHEVIKPAIFPVALELVKQHRETGDLCCVVTATNEFITR
PIAQAFGVDALIACEAETVDGEPHSPYTGRPTGTPSYKEGKIVRTEAWLASLGKTWSDFE
RSYFYSDSHNDIPLLEKVTDPIATNPDDTLRAHAQAKGWRILELFQPS