Protein Info for BPHYT_RS03545 in Burkholderia phytofirmans PsJN

Annotation: apolipoprotein acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00795: CN_hydrolase
  • amino acids 20 to 272 (253 residues), 200.3 bits, E=1.8e-63

Best Hits

Swiss-Prot: 34% identical to NIT3_YEAST: Omega-amidase NIT3 (NIT3) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K01501, nitrilase [EC: 3.5.5.1] (inferred from 100% identity to bpy:Bphyt_0727)

Predicted SEED Role

"FIG003879: Predicted amidohydrolase"

MetaCyc Pathways

• indole-3-acetate biosynthesis V (bacteria and fungi) (1/1 steps found)
• indole glucosinolate activation (herbivore attack) (8/13 steps found)
• indole-3-acetate biosynthesis II (6/12 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Cyanoamino acid metabolism
• Nitrogen metabolism
• Styrene degradation
• Tryptophan metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.5.1

Use Curated BLAST to search for 3.5.5.1

Sequence Analysis Tools

See B2SXB2 at UniProt or InterPro

Protein Sequence (283 amino acids)

>BPHYT_RS03545 apolipoprotein acyltransferase (Burkholderia phytofirmans PsJN)
MSETHVSSTVSSGSLEGAFRVAALQMVSTPDRERNLAEAGRLIAEAAAEGAQLVLLPEYF
CFMGFKDTDKLAVREPYQDGPIQRFLADAARRHQVWVIGGTLPLMSPEAARVLNTTLVFD
PQGNEVARYDKIHLFNFEKGEESFDEARTICPGGEVRTFEAPFGRVGLSVCYDLRFPELY
RRMGDCALVVVPSAFTYTTGRAHWEMLLRARAVENQCYVLAAAQGGKHENGRRTWGHSML
IDPWGEIVAVRDEGAGVVAGNLERARIDEVRQSLPAWRHRVLS