Protein Info for BPHYT_RS03460 in Burkholderia phytofirmans PsJN

Annotation: mammalian cell entry protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details PF02470: MlaD" amino acids 65 to 156 (92 residues), 52.7 bits, see alignment E=2.1e-18 amino acids 181 to 241 (61 residues), 31.8 bits, see alignment E=6.9e-12 amino acids 310 to 413 (104 residues), 39.2 bits, see alignment E=3.4e-14

Best Hits

KEGG orthology group: K06192, paraquat-inducible protein B (inferred from 100% identity to bpy:Bphyt_0709)

Predicted SEED Role

"Paraquat-inducible protein B" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SX94 at UniProt or InterPro

Protein Sequence (552 amino acids)

>BPHYT_RS03460 mammalian cell entry protein (Burkholderia phytofirmans PsJN)
MTSPQEPTPASDAPRNDSNGPKLPPQLPDPEIEPRSRWLPSLVWMIPLIAALIGIALVIK
SVTARGPTITISFVSAEGLEPGKTKVKYKDVDVGSVKTITLSKDLSHVLVQVQLTKEGED
FAVKDSRFWVVRPRVGASGVSGLTTLLSGAYIGADAGHSPDTEKNFVGLETPPPITGDQK
GHQFVLHGDSLGSIDIGSPIFYRRVQVGQVVGFSLDKDGTGVTMQVFVSAPFDQYVGTNS
RWWHASGVDLRLDSSGFKLNTQSLATVIVGGLSFQSPPGQGVGAQAPNNMTFRLGSDEAD
AMREPDGVPLRVVMNFNQSLRGLSIGAPVDFRGIVLGQVTNIGIDYDPKTRSFTMPVTMN
LYPDRLGRRFRETAPAPGSLAGQTMLQQLVKHGLRGQLRTGNLITSQLYVAVDIFPKAPP
ATVDVASDPLELPTIPNTLDELQLQVADIAKKLDKVPFDQIGNNLNSALKNADQLFTRLD
KEVVPQARDTLAAAKQTFGSAEATLQQDSPLQSDVHQALQELTRTLQSLNALSDYLERHP
ESLLRGKSGDKP