Protein Info for BPHYT_RS03420 in Burkholderia phytofirmans PsJN

Annotation: preprotein translocase subunit SecD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 687 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 450 to 470 (21 residues), see Phobius details amino acids 476 to 495 (20 residues), see Phobius details amino acids 500 to 519 (20 residues), see Phobius details amino acids 541 to 566 (26 residues), see Phobius details amino acids 572 to 599 (28 residues), see Phobius details PF13721: SecD-TM1" amino acids 1 to 112 (112 residues), 111.6 bits, see alignment E=5.9e-36 PF07549: Sec_GG" amino acids 127 to 149 (23 residues), 25.3 bits, see alignment (E = 2.1e-09) TIGR01129: protein-export membrane protein SecD" amino acids 132 to 596 (465 residues), 447.7 bits, see alignment E=4.3e-138 PF21760: SecD_1st" amino acids 239 to 297 (59 residues), 94.3 bits, see alignment 5.9e-31 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 356 to 589 (234 residues), 231.4 bits, see alignment E=1.1e-72 PF02355: SecD_SecF" amino acids 429 to 599 (171 residues), 69.3 bits, see alignment E=7.4e-23 PF03176: MMPL" amino acids 464 to 591 (128 residues), 30.5 bits, see alignment E=4.6e-11

Best Hits

KEGG orthology group: K03072, preprotein translocase subunit SecD (inferred from 100% identity to bpy:Bphyt_0701)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SX86 at UniProt or InterPro

Protein Sequence (687 amino acids)

>BPHYT_RS03420 preprotein translocase subunit SecD (Burkholderia phytofirmans PsJN)
MNRYPLWKYAVMLVALVIGLVYTLPNLFGEAPAVQVSSGKATVKLDSTTLSAVEAALAAN
QIKPDDVTFDNSATNANIRVRLPDTDTQLRVKDLLQKSLNSDPTDPQYIVALNLQSASPR
WLTALHALPMYLGLDLRGGVHFLLQVDMAGALNKKLDSDASDARTLLRDKNIRDGGVNRV
NQSVVINFADQATADNASKQLSRSIAELQWASQAGPDGGVQLVGTFTPAVQKAVQDAALK
QNITTLHNRVNELGVAEPVIQQQGADRIVVELPGVQDTAKAKDIIGRTATLEARLADPVN
THPNPSDPVPPGDELFTQGNQTPVLLRKQIIFTGDRIIDASAGFDEHQRPSVNIRLDSAG
GRAVASISRDNIGKPMAMVLFEKGKGEVLTVATIQSELGDRFQITGQATPQGAADLALLL
RAGSLAAPMDIIEERTIGPSLGADNIKKGFHSVVWGFAAIAVFMIAYYMLFGVISMIGLS
VNLLLLIAVLSMLQATLTLPGIAAIALALGMAIDANVLINERVREELRNGAPPQLAIQNG
YAHAWATILDSNVTTLIAGIALLAFGSGPVRGFAIVHCIGILTSMFSAVFFSRGIVNLWY
GGKKKLKSLAIGQVWRPETAPAGAAAYLGSEDAATDTAQAVAAVAAKPSKARAAVAQARA
GKPTVRRRNAPDSSATSNTPQKPGSSR