Protein Info for BPHYT_RS03410 in Burkholderia phytofirmans PsJN

Annotation: queuine tRNA-ribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 TIGR00449: tRNA-guanine family transglycosylase" amino acids 29 to 395 (367 residues), 504.7 bits, see alignment E=1.3e-155 TIGR00430: tRNA-guanine transglycosylase" amino acids 34 to 395 (362 residues), 532.3 bits, see alignment E=5.8e-164 PF01702: TGT" amino acids 36 to 397 (362 residues), 540.3 bits, see alignment E=1.1e-166

Best Hits

Swiss-Prot: 83% identical to TGT_CUPMC: Queuine tRNA-ribosyltransferase (tgt) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K00773, queuine tRNA-ribosyltransferase [EC: 2.4.2.29] (inferred from 100% identity to bpy:Bphyt_0699)

MetaCyc: 63% identical to tRNA-guanine transglycosylase (Escherichia coli K-12 substr. MG1655)
tRNA-guanine transglycosylase. [EC: 2.4.2.29]

Predicted SEED Role

"tRNA-guanine transglycosylase (EC 2.4.2.29)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 2.4.2.29)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SX84 at UniProt or InterPro

Protein Sequence (404 amino acids)

>BPHYT_RS03410 queuine tRNA-ribosyltransferase (Burkholderia phytofirmans PsJN)
MTDGQSVSPRADHGAYLGDHVRPDNGLNFELLGVDGLARRGRVTLNHGVVETPIFMPVGT
YGTVKAVQPRELEEMHAQIILGNTFHLWLRPGLETIEAHGGLHGFMGWKKPILTDSGGFQ
VFSLGDLRKITEDGVTFASPINGDKLFLSPEVSMQIQKVLNSDIVMQFDECTPYATNNVP
TSHQEAADSMRMSMRWAQRSIDEFRRLGNPNALFGIVQGGMFEDLRDESLAGLAEKDFHG
LAIGGLSVGEPKEDMMRVLNHIGPKLPANKPHYLMGVGTPEDLVAGVAAGVDMFDCVMPT
RNARNGWLFTRFGDVKIRNAAHKNSLRPLDEQCGCYTCRNFTRGYLHHLHRVGEILGAQL
NTIHNLHYYLELMQEIRDAIDAKMFEAFRKRFHENRARGTAEAP