Protein Info for BPHYT_RS03340 in Burkholderia phytofirmans PsJN

Annotation: D,D-heptose 1,7-bisphosphate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01662: HAD hydrolase, family IIIA
  • amino acids 5 to 144 (140 residues), 122.9 bits, E=1.1e-39
• TIGR01656: histidinol-phosphate phosphatase domain
  • amino acids 6 to 145 (140 residues), 156.6 bits, E=4.3e-50
• PF08645: PNK3P
  • amino acids 9 to 129 (121 residues), 39.3 bits, E=1.1e-13
• PF00702: Hydrolase
  • amino acids 13 to 141 (129 residues), 50.1 bits, E=9.4e-17
• PF13419: HAD_2
  • amino acids 96 to 142 (47 residues), 26 bits, E=1.9e-09
• PF13242: Hydrolase_like
  • amino acids 102 to 172 (71 residues), 49.5 bits, E=6.4e-17

Best Hits

Swiss-Prot: 62% identical to GMHBB_BORBR: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (BB4091) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 100% identity to bpy:Bphyt_0685)

Predicted SEED Role

"D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase (EC 3.1.1.-); Histidinol-phosphatase (EC 3.1.3.15)" (EC 3.1.1.-, EC 3.1.3.15)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• 2,4-Dichlorobenzoate degradation
• Alkaloid biosynthesis II
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Ether lipid metabolism
• Fructose and mannose metabolism
• Glycerophospholipid metabolism
• Histidine metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Retinol metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-, 3.1.3.-, 3.1.3.15

Use Curated BLAST to search for 3.1.1.- or 3.1.3.- or 3.1.3.15

Sequence Analysis Tools

See B2SX70 at UniProt or InterPro

Protein Sequence (184 amino acids)

>BPHYT_RS03340 D,D-heptose 1,7-bisphosphate phosphatase (Burkholderia phytofirmans PsJN)
MPTKKVVILDRDGVINVDSDAFIKSPDEWVALPGSLEAIARLNQAGYRVAIATNQSGIGR
GLFDMNALNAMHLKMHRMAAAVGGRIDAVFFCPHTAEDHCECRKPKPGMLKMINERFEVD
PEQTPVVGDSLRDLQAGASLGHPAHLVLTGKGRKTLEAGGLPEGTIVHDDLRAFALDFLA
DAQE