Protein Info for BPHYT_RS03295 in Burkholderia phytofirmans PsJN

Annotation: molecular chaperone SurA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF13624: SurA_N_3" amino acids 10 to 157 (148 residues), 56.5 bits, see alignment E=9.2e-19 PF13623: SurA_N_2" amino acids 32 to 118 (87 residues), 40.1 bits, see alignment E=1e-13 PF09312: SurA_N" amino acids 41 to 158 (118 residues), 116.5 bits, see alignment E=2.3e-37 PF13616: Rotamase_3" amino acids 189 to 291 (103 residues), 48.2 bits, see alignment E=4.7e-16 amino acids 305 to 403 (99 residues), 91.9 bits, see alignment E=1.3e-29 PF00639: Rotamase" amino acids 195 to 289 (95 residues), 66.1 bits, see alignment E=1.5e-21 amino acids 311 to 400 (90 residues), 85.8 bits, see alignment E=9.9e-28 PF13145: Rotamase_2" amino acids 211 to 296 (86 residues), 37.6 bits, see alignment E=1.1e-12 amino acids 331 to 406 (76 residues), 28 bits, see alignment E=9.7e-10

Best Hits

Swiss-Prot: 95% identical to SURA_PARXL: Chaperone SurA (surA) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K03771, peptidyl-prolyl cis-trans isomerase SurA [EC: 5.2.1.8] (inferred from 100% identity to bpy:Bphyt_0676)

Predicted SEED Role

"Survival protein SurA precursor (Peptidyl-prolyl cis-trans isomerase SurA) (EC 5.2.1.8)" in subsystem Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SX61 at UniProt or InterPro

Protein Sequence (453 amino acids)

>BPHYT_RS03295 molecular chaperone SurA (Burkholderia phytofirmans PsJN)
MAIMKKLRLATLAAGLAAAASFLSVAPVQAQALGGSSGQTVDTIAAVVNNGVITRRELDE
RMSLITRRLNQQNAPVPPLDQLRQQVLNQMVLERIQLQKAKEDNINIDDATVQKTLERLA
AANNLSLDVYRSRIEAQGVPWSTFTSDARTELTLSRLREKEVDSKVTVSDAEVANYIASQ
RGPNAGATSDLHLQHIFLKAPLNAPETDIEAAQQKAQALLAEAKGGANFDKLAKSNSQAP
DASKGGDTGFVAPSKLPPEVVKAVSTMRPGEVNPDLIRTNDGFEIVRLVDRRAGQGTSSD
APKLVQTHVRHILLRVGDGMSEPQARQKLLEIKKEIAAGGDFAKFAHTYSQDGSSSQGGD
LGWISPGETVPEFERAMNNLQDGQISDPVRSEYGYHLIQVLGRRESEGSVSQQMDLARQA
IGQRKAEQAYADWLRELRDTAYVEVKPTLSSTQ