Protein Info for BPHYT_RS03250 in Burkholderia phytofirmans PsJN

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1036 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 184 to 205 (22 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 224 to 346 (123 residues), 52.8 bits, see alignment E=4.4e-18 amino acids 349 to 473 (125 residues), 24.7 bits, see alignment E=2.1e-09 amino acids 500 to 599 (100 residues), 60.2 bits, see alignment E=2.2e-20 PF08448: PAS_4" amino acids 231 to 340 (110 residues), 25.6 bits, see alignment E=4.2e-09 amino acids 359 to 469 (111 residues), 50.6 bits, see alignment E=7.1e-17 amino acids 500 to 592 (93 residues), 26.9 bits, see alignment E=1.7e-09 PF13426: PAS_9" amino acids 237 to 338 (102 residues), 21.3 bits, see alignment E=9.4e-08 amino acids 487 to 591 (105 residues), 73.4 bits, see alignment E=5.7e-24 PF00989: PAS" amino acids 498 to 589 (92 residues), 34.2 bits, see alignment E=7.7e-12 PF08447: PAS_3" amino acids 501 to 586 (86 residues), 28.7 bits, see alignment E=4.5e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 599 to 762 (164 residues), 148.7 bits, see alignment E=1.3e-47 PF00990: GGDEF" amino acids 603 to 759 (157 residues), 163.7 bits, see alignment E=1.1e-51 PF00563: EAL" amino acids 780 to 1015 (236 residues), 267.5 bits, see alignment E=3.4e-83

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0667)

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SX52 at UniProt or InterPro

Protein Sequence (1036 amino acids)

>BPHYT_RS03250 diguanylate cyclase (Burkholderia phytofirmans PsJN)
MTPFLSKRLLINLAVVAAAIGANAFVAYTQICGQRDADARMLRSTSVRQHLDAYHTALDG
GLAALGRFEASGEPAPASAAAAMATRLTGLERDLRNELAGEPAMLDALAKLSADSHALQH
DIDDALLRSDAAGPDASRAWAASTYTYLGLGLDRVEAGLASLRGAENRALQASLAASASE
SQRAMFLLIVTMLGGSVLLIFTFGARENSAREKLRSVRALGRHDERFRGLFDEHPVPMYI
FDRETLRFLAVNAAAIQQYGYTESEFLGMTIRAIRPNGEISRLESHMQRSDAGQHGRTMA
GIWHHRRKDGSTINADISYHALNFMGRAAFFVLADDVTDQINAEAEAQRSNQMLEAVIDN
IPQRIFWKDMESRYLGCNMAFARDAGLAYPEQVVGKSDADMPWRDFSTLLNDHDKEVVST
GVPKMNFEVDLVIDGVHRTTVTSKLPFTDGDGRVIGVLGSYTDITERKRADLALRLQSRA
LDASVNAILITAPSPTGNLIEYVNPAFMRITGYDATEVIGHDCRVLQRDDREQEGVALIR
QALAANREVSAVVRNYRKDGALFWNQLFIAPVPNQDGVITHHIGVINDVTDLMRYQEQLE
YQANYDSLTRLPNRNLLRDRLQHALIVAQRHHKGVAVVFMDLDGFKNVNDSLGHSVGDRL
LGVVAERLARCTRTSDTVARHGGDEFVIVMTDTVDEQSLIAWMERVRASISEPVWLDGTE
LYVGCSMGASLFPQDGEDAETLMKKADLAMYRAKDMGRNTFQFYQPEMNASAGARLNLER
RLRRALRDNEFLLHYQPQVDIESGQIVGTEALVRWRDPEVGLVPPSSFIPVAEESGLIGP
LSEWVLREACRQNKAWQDEGLPPARVSVNLSARVFQQRDIAKLVMQVLAETGLEPQYLEL
ELTESTIMRNAEEAVSMLNELHALGIGLAIDDFGTGYSSLSYLKRFPVDRLKIDRSFVSD
IGVSGDDETITSAIIALAHSLKLQVIAEGVETSAQLDFLKERACDEMQGFYFAKPLSTDA
ISELLQGGIGRELATV