Protein Info for BPHYT_RS03220 in Burkholderia phytofirmans PsJN

Updated annotation (from data): Acyl-CoA dehydrogenase (EC 1.3.8.7)
Rationale: Specifically important for: Tween 20; Trisodium citrate dihydrate. Tween 20 hydrolyzes to a mix of C12, C14, and C16 fatty acids; this is probably part of beta oxidation. The phenotype on citrate is milder and is not explained, but it is conserved. (SEED_correct)
Original annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 595 PF12418: AcylCoA_DH_N" amino acids 3 to 35 (33 residues), 50.5 bits, see alignment (E = 4e-17) PF02771: Acyl-CoA_dh_N" amino acids 42 to 158 (117 residues), 40.7 bits, see alignment E=7.1e-14 PF02770: Acyl-CoA_dh_M" amino acids 164 to 273 (110 residues), 55.4 bits, see alignment E=1.4e-18 PF00441: Acyl-CoA_dh_1" amino acids 283 to 451 (169 residues), 73.7 bits, see alignment E=4.8e-24 PF12806: Acyl-CoA_dh_C" amino acids 470 to 590 (121 residues), 120.5 bits, see alignment E=1.2e-38

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 100% identity to bpy:Bphyt_0661)

Predicted SEED Role

"Acyl-CoA dehydrogenase (EC 1.3.8.7)" (EC 1.3.8.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7, 1.3.99.-

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SX46 at UniProt or InterPro

Protein Sequence (595 amino acids)

>BPHYT_RS03220 Acyl-CoA dehydrogenase (EC 1.3.8.7) (Burkholderia phytofirmans PsJN)
MGQYAAPLRDMQFVLHELLNVEAEIKQMPKHADLDADTINAVLEEAGKFCSEVLFPLNHS
GDQEGCTYVGDGVVTTPKGFKEAYAQYVEAGWPALGCDPEYGGQGLPAFVNNALYEMLNS
ANQAWTMYPGLSHGAYECLHAHGTPELQQRYLPKLVAGVWTGTMCLTEPHCGTDLGILRT
KAEPNSDGSYAISGTKIFISSGEHDLAENIVHLVLARLPGAPNGTKGISLFIVPKFVPNE
AGEPGERNGVKCGSIEHKMGIHGNATCVINLDNAKGWLVGEPNKGLNAMFVMMNAARLGV
GMQSLGLTEIGYQNSLTYAKERLQMRSLTGPKAPEKAADPIIVHPDVRRMLLTQKAYAEA
ARAFSYWSALHIDKELSHADESVRKEAADLVALLTPILKAFLSDNAFESTNHAMQIYGGH
GFIAEWGMEQYVRDARINMIYEGTNAIQALDLLGRKILGDMGAKMKKFGKLVSDFVEAEG
VKPEMQEFINPLADIGEKVQKLTMEIGMKAMQNPDEVGAAAVPYLRTVGHLVFSYFWARM
ARVALDKEASGDPFYKAKLATARFYFAKLLPETAMTIRQARAGSKSLMDVEEALF