Protein Info for BPHYT_RS03105 in Burkholderia phytofirmans PsJN

Annotation: DSBA oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details amino acids 314 to 332 (19 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 370 to 393 (24 residues), see Phobius details amino acids 413 to 434 (22 residues), see Phobius details amino acids 490 to 510 (21 residues), see Phobius details PF07690: MFS_1" amino acids 28 to 422 (395 residues), 187.8 bits, see alignment E=4.2e-59 PF06609: TRI12" amino acids 41 to 441 (401 residues), 36 bits, see alignment E=4.4e-13 PF00083: Sugar_tr" amino acids 58 to 194 (137 residues), 32.4 bits, see alignment E=7.4e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0637)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXM1 at UniProt or InterPro

Protein Sequence (531 amino acids)

>BPHYT_RS03105 DSBA oxidoreductase (Burkholderia phytofirmans PsJN)
MAVHTAAHHSSGQVLPFRESLLAMLGISFVTMLVALDQTVVGTALPTIVAELKGFELYAW
VATSYLLTSVITVPIFGRLGDYYGRKPFVIASIVVFTAASVLCGMANNMLFLVLARGLQG
IGGGMLVGTAFACIPDLFPDSVVRLRWQVLMSSAFGIANAVGPSLGGFLTQYYGWRSVFY
VNLPVGLLSLFFVWRFLPHLRHVEHEGKMRLDWPGAVLIAVALGSLQLFVELLPKHGVTL
GAIALLVLSVASAYALWQWEKRCPTAILPVDMFRNRSLAALFTLAVLGGFSMFSLLFYAP
LLFQGGFGMSPKEAGLVITPLVVFITIGSIANGRIVSRVRNPNLMLYIGFTLLALACLGV
VVATRAMPQWLLMSFMIVGGLGLGFVMPNLTIFAQQTAGREHLGIATALLQSLRMIGGMI
GTALTGTLVSHMYASGVRSALDNDHASQWLADLGDPQILINRDAQATLLGQLTHAGHNGA
MLLETAREALVSAIHLGLAMAAIIAAVSVWQSRRVPPIKLQRKLEPVIHAD