Protein Info for BPHYT_RS03080 in Burkholderia phytofirmans PsJN

Annotation: aquaporin Z

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 164 to 183 (20 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details PF00230: MIP" amino acids 6 to 225 (220 residues), 162.1 bits, see alignment E=9e-52 TIGR00861: MIP family channel proteins" amino acids 11 to 225 (215 residues), 174.3 bits, see alignment E=1.6e-55

Best Hits

Swiss-Prot: 55% identical to AQPZ_BORBR: Aquaporin Z (aqpZ) from Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0632)

Predicted SEED Role

"Aquaporin Z"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXL2 at UniProt or InterPro

Protein Sequence (248 amino acids)

>BPHYT_RS03080 aquaporin Z (Burkholderia phytofirmans PsJN)
MDALGKRLLFEGVGTAWLVFVGCGSIVLNVGAIQQAGGVLEVALAFGLALATAIYCFGGV
SGGHFNPAVTVGFTVAQRFPVRDLLPYIASQILGAIVAAALLLYVAGGRPGFDLAASEFA
ANGFGDHSPADYQLHSAVAVEFVLAFGFVMASLLIAHRRDMAPIAPLVIGACLVLVYLVS
IPVTNGSVNPARSTAQALFVGDWALDQLWLFWAAPLSGGVMAGALFSFVHGKADLAAATL
ADGRGEVA