Protein Info for BPHYT_RS03035 in Burkholderia phytofirmans PsJN

Annotation: cytochrome C oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 541 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 87 to 108 (22 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 166 to 191 (26 residues), see Phobius details amino acids 209 to 233 (25 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 279 to 305 (27 residues), see Phobius details amino acids 327 to 347 (21 residues), see Phobius details amino acids 366 to 384 (19 residues), see Phobius details amino acids 405 to 425 (21 residues), see Phobius details amino acids 446 to 470 (25 residues), see Phobius details amino acids 502 to 520 (19 residues), see Phobius details PF00115: COX1" amino acids 6 to 457 (452 residues), 291.4 bits, see alignment E=6.1e-91

Best Hits

KEGG orthology group: K02274, cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 100% identity to bpy:Bphyt_0622)

Predicted SEED Role

"Cytochrome c oxidase (B(O/a)3-type) chain I (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXK2 at UniProt or InterPro

Protein Sequence (541 amino acids)

>BPHYT_RS03035 cytochrome C oxidase subunit I (Burkholderia phytofirmans PsJN)
MFHAKRLVLAHFWLAFIAFLIALLLGAWQMLVRSPFLPWVGDPELYYRSVTAHGSVMAYV
MPTLVSMGFGYAIVELALAQRLVGLKWAWAAFIMLAVGAVMAMVPVALGQASVLYTFYPP
MIGSPFYYLGVVLVVVGSWIWVALMHVNLRVWKRANPGKPVPLAMFANVAGAYLWAWTAV
GAALEILFQILPVAFGLTNTIDAGLSRILFSWTLHAIVYFWLIPAYIAYYTLVPRAIGGR
LYSDSMARVSFILFLVFAMPIGIHHLFADPQVGSGFKFLHAVFTGMVSVPTLLTVFTICA
SVEIAGRLRGGKGAFGWLTALPWQNPMMLVIAFSFVMLGLGGAGGLINMSYQLNSTVHNT
QWVTGHFHLIFGGAIVIMYFAIAYELWPQLTGRAIASVKLVRTQLWLWFIGMMVVTLPWH
YVGLLGAPRRMAYYDYNALGLQSQALWVGMSAVGGLILVASGVLFIYILVKSQFGPLVQQ
QSFRFASAAQPVDRVPAALNSFGLWVALMIGLTVVNYSVPIVQLLRLPQTSVPAVVVGAQ
R