Protein Info for BPHYT_RS03000 in Burkholderia phytofirmans PsJN

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 transmembrane" amino acids 82 to 100 (19 residues), see Phobius details PF02771: Acyl-CoA_dh_N" amino acids 10 to 120 (111 residues), 103.1 bits, see alignment E=2.3e-33 PF02770: Acyl-CoA_dh_M" amino acids 125 to 219 (95 residues), 81.4 bits, see alignment E=8.9e-27 PF00441: Acyl-CoA_dh_1" amino acids 233 to 381 (149 residues), 172.9 bits, see alignment E=1e-54 PF08028: Acyl-CoA_dh_2" amino acids 250 to 365 (116 residues), 83.6 bits, see alignment E=3e-27

Best Hits

Swiss-Prot: 36% identical to ACADS_MOUSE: Short-chain specific acyl-CoA dehydrogenase, mitochondrial (Acads) from Mus musculus

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0615)

Predicted SEED Role

"Acyl-CoA dehydrogenase, short-chain specific (EC 1.3.99.2)" in subsystem Isoleucine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXJ5 at UniProt or InterPro

Protein Sequence (387 amino acids)

>BPHYT_RS03000 acyl-CoA dehydrogenase (Burkholderia phytofirmans PsJN)
MTATELDTLENDQLILDMLDRFLETEVRPYVHKFDHDDIYPAEIVEKMKEMGLFGCIIDP
EYGGLGLSTRTYAQIIARISRVWMSVSGIINSHLILAMLVQRNGTPEQKSKYLPKFATGE
WRGGIGLTEPDCGTDLQAIRTTAKRVGDEYIVNGNKTWITNSKHGNTLALLVKTDTTAQP
RHLGMSLLLVQKGPGFEVSRQLEKLGYKGIDTCELSFHDYHVSTDALIGGVEGRGLQQIL
GGLELGRINVAARGVGVAQAALDESVSYSQQRKTFGKPICEHQAIQLKLGEMATRVEAGR
LLVDAAAKKYDRGERCDMEAGMAKYFATEAALENSVEAMRIHGAYGYSKEYNVERLYRDA
PLLTIGEGTNEMQRIIIAKQLIERSPI