Protein Info for BPHYT_RS02900 in Burkholderia phytofirmans PsJN

Annotation: ribosome hibernation promoting factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 118 TIGR00741: ribosomal subunit interface protein" amino acids 1 to 103 (103 residues), 99.6 bits, see alignment E=6.2e-33 PF02482: Ribosomal_S30AE" amino acids 3 to 98 (96 residues), 94.9 bits, see alignment E=2.1e-31

Best Hits

Swiss-Prot: 74% identical to HPF_CUPNH: Ribosome hibernation promoting factor (hpf) from Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337)

KEGG orthology group: K05808, putative sigma-54 modulation protein (inferred from 100% identity to bpy:Bphyt_0595)

Predicted SEED Role

"Ribosome hibernation protein YhbH" in subsystem Ribosome activity modulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXH5 at UniProt or InterPro

Protein Sequence (118 amino acids)

>BPHYT_RS02900 ribosome hibernation promoting factor (Burkholderia phytofirmans PsJN)
MNLQISGHHLEVTPALREYVITKLDRVLRHFDQVIDGSVVLSVDNHKEKDKRQKVEINLH
LKGKDIFVESCDSDLYAAIDLMIDKLDRQVIRHKDRLQGHAHEAIKYQPAPQLDVPPQ