Protein Info for BPHYT_RS02890 in Burkholderia phytofirmans PsJN

Annotation: HPr kinase/phosphorylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF02603: Hpr_kinase_N" amino acids 7 to 135 (129 residues), 81.2 bits, see alignment E=7e-27 TIGR00679: HPr(Ser) kinase/phosphatase" amino acids 13 to 308 (296 residues), 311.6 bits, see alignment E=2.8e-97 PF07475: Hpr_kinase_C" amino acids 139 to 305 (167 residues), 202.1 bits, see alignment E=4.7e-64

Best Hits

Swiss-Prot: 100% identical to HPRK_PARPJ: HPr kinase/phosphorylase (hprK) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K06023, HPr kinase/phosphorylase [EC: 2.7.11.- 2.7.4.-] (inferred from 99% identity to bxe:Bxe_A4125)

Predicted SEED Role

"HPr kinase/phosphorylase (EC 2.7.1.-) (EC 2.7.4.-)" in subsystem Mannitol Utilization (EC 2.7.1.-, EC 2.7.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.-, 2.7.4.-

Use Curated BLAST to search for 2.7.1.- or 2.7.11.- or 2.7.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXH3 at UniProt or InterPro

Protein Sequence (322 amino acids)

>BPHYT_RS02890 HPr kinase/phosphorylase (Burkholderia phytofirmans PsJN)
MDTSSINAQSIFDDNAAMLKLSWLTGHEGWERGFSSESVANATSSADLVGHLNLIHPNRI
QVLGDAEIDYYKRQTDEDRSRHMAELIALEPPFLVVAGGVAAPPELVLRCTRSSTPLFTT
PMSAAAVIDSLRLYMSRILAPRATLHGVFLDILGMGVLLTGDSGLGKSELGLELISRGHG
LVADDAVDFVRLGPDFVEGRCPPLLQNLLEVRGLGLLDIKTIFGETAVRRKMKLKLIVQL
VRRPDGEFQRLPLESQTVDVLGLPISKVTIQVAAGRNLAVLVEAAVRNTILQLRGIDTLR
DFMDRQRLAMQDPDSQFPGKLI