Protein Info for BPHYT_RS02855 in Burkholderia phytofirmans PsJN

Annotation: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00154: 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  • amino acids 13 to 286 (274 residues), 261.1 bits, E=7.6e-82
• PF00288: GHMP_kinases_N
  • amino acids 91 to 149 (59 residues), 64.2 bits, E=1.2e-21
• PF08544: GHMP_kinases_C
  • amino acids 218 to 276 (59 residues), 36.9 bits, E=4.1e-13

Best Hits

Swiss-Prot: 100% identical to ISPE_PARPJ: 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (ispE) from Paraburkholderia phytofirmans (strain DSM 17436 / LMG 22146 / PsJN)

KEGG orthology group: K00919, 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC: 2.7.1.148] (inferred from 100% identity to bpy:Bphyt_0586)

Predicted SEED Role

"4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (EC 2.7.1.148)" in subsystem Isoprenoid Biosynthesis or polyprenyl synthesis (EC 2.7.1.148)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (10/12 steps found)
• taxadiene biosynthesis (engineered) (10/13 steps found)
• methylerythritol phosphate pathway I (7/9 steps found)
• isoprene biosynthesis I (7/10 steps found)
• superpathway of ergosterol biosynthesis II (11/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.148

Sequence Analysis Tools

See B2SXG6 at UniProt or InterPro

Protein Sequence (293 amino acids)

>BPHYT_RS02855 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (Burkholderia phytofirmans PsJN)
MIETTDSLRDCLAPAKLNLFLHITGRRPDGYHTLQTVFQLLDWGDTLHFTRRDDGLITRS
TEIADVPPEHDLTVRAATLLKAHTGSPEGVDIEIDKRLPMGAGLGGGSSDAATTLLALNR
LWKLNLPRLELQALALKLGADVPFFVFGKNAFAQGVGEALDVVQLPPRHFLVVTPRVHVP
TAAIFSEKALTRDSKPLTITDFPAELSCNTEWPESFGRNDMQQVVVGKYAEVAQVLRWFE
NVAPARMSGSGASVFAAFRSKAEAEAAQAKLPAEWNSAVTASLDQHPLFTFAS