Protein Info for BPHYT_RS02825 in Burkholderia phytofirmans PsJN

Annotation: ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 85 PF00037: Fer4" amino acids 6 to 25 (20 residues), 26.3 bits, see alignment 4.7e-10 PF12838: Fer4_7" amino acids 9 to 57 (49 residues), 30.5 bits, see alignment E=4e-11

Best Hits

Swiss-Prot: 70% identical to FER_ALLVD: Ferredoxin (fdx) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0581)

Predicted SEED Role

"4Fe-4S ferredoxin, iron-sulfur binding"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SXG1 at UniProt or InterPro

Protein Sequence (85 amino acids)

>BPHYT_RS02825 ferredoxin (Burkholderia phytofirmans PsJN)
MALMITDECINCDVCEPECPNDAISMGPEIYVIDPKKCTECVGHFDEPQCIQVCPVECIP
RDPDHLETPDGLMAKYHALQAAKGA