Protein Info for BPHYT_RS02560 in Burkholderia phytofirmans PsJN

Annotation: glutathione synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 PF02951: GSH-S_N" amino acids 1 to 124 (124 residues), 139 bits, see alignment E=1.2e-44 TIGR01380: glutathione synthase" amino acids 1 to 316 (316 residues), 402.7 bits, see alignment E=4.5e-125 PF02955: GSH-S_ATP" amino acids 128 to 301 (174 residues), 241.4 bits, see alignment E=6.1e-76 PF08443: RimK" amino acids 154 to 312 (159 residues), 37.5 bits, see alignment E=2.8e-13

Best Hits

Swiss-Prot: 58% identical to GSHB_NEIMA: Glutathione synthetase (gshB) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)

KEGG orthology group: K01920, glutathione synthase [EC: 6.3.2.3] (inferred from 100% identity to bpy:Bphyt_0528)

Predicted SEED Role

"Glutathione synthetase (EC 6.3.2.3)" in subsystem Glutathione: Biosynthesis and gamma-glutamyl cycle or Heat shock dnaK gene cluster extended (EC 6.3.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SX09 at UniProt or InterPro

Protein Sequence (318 amino acids)

>BPHYT_RS02560 glutathione synthetase (Burkholderia phytofirmans PsJN)
MDILFIADPLTQFKIYKDSTYAMMAEAARRGHVVYTCEPKHLAWTGGDVEANVQRFTIVG
DVTDLHREVWYDAEAAAPRSLKSFSAVVMRKDPPFDMEYVTSTWLLEMAERGGARIFNKP
QAIRDHSEKLAIGEFAQFVTPTLVTRDASRLRAFHEEHGDVILKPLDGMGGMGVFRVKAD
GMNLGSIIEMLSHDGARSVMAQKFIPEIKEGDKRILLIGGEAVPYSLARIPQGNEVRGNL
AAGGLGVARPLTEHDRKIADTLAPVLAARGLLLVGLDAIGDWLTEVNVTSPTCFREIMDQ
TGFDVAAMFIDALERAAG