Protein Info for BPHYT_RS02510 in Burkholderia phytofirmans PsJN

Annotation: C4-dicarboxylate ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 transmembrane" amino acids 8 to 27 (20 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 77 to 99 (23 residues), see Phobius details amino acids 144 to 167 (24 residues), see Phobius details amino acids 184 to 210 (27 residues), see Phobius details amino acids 225 to 250 (26 residues), see Phobius details amino acids 306 to 318 (13 residues), see Phobius details amino acids 348 to 374 (27 residues), see Phobius details PF00375: SDF" amino acids 9 to 401 (393 residues), 374 bits, see alignment E=4.5e-116

Best Hits

Swiss-Prot: 98% identical to DCTA_PARXL: C4-dicarboxylate transport protein (dctA) from Paraburkholderia xenovorans (strain LB400)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 100% identity to bpy:Bphyt_0518)

MetaCyc: 63% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate, aspartate"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SWZ9 at UniProt or InterPro

Protein Sequence (426 amino acids)

>BPHYT_RS02510 C4-dicarboxylate ABC transporter (Burkholderia phytofirmans PsJN)
MKKPIHKVLYVQVIVAIIIGIALGHFYPNLAVDMKPLGDGFIKLIKMVIGPIIFCTVVTG
IAGMEDMKKVGRVGGKALLYFEIVSTFALVLGLIATHVLKPGVGFNIDPATLDGKAVASY
AAKAHGQTTVDFLMHLIPDTLVSAFAQGEILQILLIALLFGAVLATAGEKGKVVTSFIDG
LSHVLFGIVRIITKLAPIGAFGAMAFTIGKYGIGSLLPMLKLIGTFYLTSIVFVVVVLGI
IARAVGFNILRFVAYIKEEMLIVLGTSSSEAALPQLMLKLEKLGCSRSVVGLVVPTGYSF
NLDGTNIYMTMAVLFIAQATNTDLTWTQQLTLLAVTMLTSKGASGVTGAGFITLAATLAV
VPTIPLSGMVLILGIDRFMSECRALTNIVGNGVATVVVSAWEKELDRNKLNAALRGDVPI
KEPAGV