Protein Info for BPHYT_RS02455 in Burkholderia phytofirmans PsJN

Annotation: taurine ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details PF04069: OpuAC" amino acids 17 to 251 (235 residues), 56 bits, see alignment E=9.8e-19 TIGR01729: taurine ABC transporter, periplasmic binding protein" amino acids 19 to 323 (305 residues), 348.3 bits, see alignment E=2e-108 PF12974: Phosphonate-bd" amino acids 31 to 231 (201 residues), 46.9 bits, see alignment E=5.1e-16 PF13379: NMT1_2" amino acids 33 to 237 (205 residues), 45.3 bits, see alignment E=2e-15 PF09084: NMT1" amino acids 43 to 226 (184 residues), 60.5 bits, see alignment E=4.6e-20

Best Hits

Swiss-Prot: 39% identical to TAUA_ECOLI: Taurine-binding periplasmic protein (tauA) from Escherichia coli (strain K12)

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_0507)

MetaCyc: 39% identical to taurine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-64-RXN [EC: 7.6.2.7]

Predicted SEED Role

"Taurine-binding periplasmic protein TauA" in subsystem Taurine Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SWY8 at UniProt or InterPro

Protein Sequence (327 amino acids)

>BPHYT_RS02455 taurine ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MLALSAPFASVAHADTKEVVIAYQDMVVPWRYAQATGEVEKATGYKVTYRKLGSGADVIR
ALASGSVQLGEAGSSPIAAGLSQGVDISLFWILDNINDAEALVARDGSNVTSVAGLKGKK
IGVPFVSTSHFHTLVALQSAGVNPSDVKIVNLRPPEVAAAWERGDIDATYIWDPVLAKVK
KNGKVLITSGQVAQQTGKATFDGFVVDRKFASQNAEFVARFVKVLAATDASYREHTSAWT
AASPQVEAVAKESGANAQQVPASLALYAFPTPAQQASNAWLGGGAQSGAAKSLAATAAFL
KTQGTIQSVLADYSTGVDPQFVQRAAH