Protein Info for BPHYT_RS02445 in Burkholderia phytofirmans PsJN

Annotation: lipoyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF16881: LIAS_N" amino acids 44 to 87 (44 residues), 33.3 bits, see alignment 5.7e-12 TIGR00510: lipoyl synthase" amino acids 47 to 330 (284 residues), 429.2 bits, see alignment E=4.4e-133 PF04055: Radical_SAM" amino acids 102 to 266 (165 residues), 88.3 bits, see alignment E=6.8e-29

Best Hits

Swiss-Prot: 90% identical to LIPA_BURP0: Lipoyl synthase (lipA) from Burkholderia pseudomallei (strain 1106a)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 100% identity to bpy:Bphyt_0504)

MetaCyc: 63% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.8

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SWY5 at UniProt or InterPro

Protein Sequence (335 amino acids)

>BPHYT_RS02445 lipoyl synthase (Burkholderia phytofirmans PsJN)
MTDVTANLAASPAPDAVPASAAAYDATAKQKAQAKTARIPIKIVPIEKLKKPDWIRVKAA
TGNSRFYEIKQILREHNLHTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHG
RPDPLDVDEPGNLARTIAALKLKYVVITSVDRDDLRDGGAAHFVECIRQTRELSPETRIE
ILTPDFRGRLDRAIGILNAAPPDVMNHNLETVPRLYKEARPGSDYAHSLKLLKDFKALHP
DVATKSGLMVGLGETEEEILQVMRDLREHNVDMLTIGQYLQPSEHHLPVRSYVHPDTFKM
YEEEAYKMGFTHAAVGAMVRSSYHADLQAHGAGVV