Protein Info for BPHYT_RS02400 in Burkholderia phytofirmans PsJN

Annotation: teicoplanin resistance protein VanZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 54 to 79 (26 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 284 to 304 (21 residues), see Phobius details amino acids 313 to 333 (21 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details PF04892: VanZ" amino acids 19 to 133 (115 residues), 43.6 bits, see alignment E=2.3e-15

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0495)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SWX6 at UniProt or InterPro

Protein Sequence (385 amino acids)

>BPHYT_RS02400 teicoplanin resistance protein VanZ (Burkholderia phytofirmans PsJN)
MSVKPWARRPSVLARQALVLYTALIVYGSWYPFSGWRSLGLAPFAYLSDPMPQYLTAFDV
VTNVLGYMPFGALVVLAAYPRWRGTLAVAFAFVLGGLLSGVMEAVQTYLPTRVASNLDLA
ANALGALLGAAIMSPATGALLDRGLLRRARLLWFERDRAALACLIVAWPFATMYPAPRLF
GLGNWPRALWLRFDSTTQDALLAWTPPGWHVGAWPALVAAWMPDDVWEAVITTLNLFAAL
ALASLPARRHAPRVRLLLLFIVVTLCVKAGATFLQSQSGLAFDWATPGAFAGLVCGTAAA
LLTLRLQRRSRAALAGVALTIALVFVNLLPVNPYFDAVLADWRQGRYLHFNGLAHWLAWI
WPYAALVWLAYVVEQAWLKRRMKHA