Protein Info for BPHYT_RS02380 in Burkholderia phytofirmans PsJN

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 transmembrane" amino acids 121 to 147 (27 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 201 to 225 (25 residues), see Phobius details amino acids 260 to 293 (34 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details amino acids 350 to 371 (22 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 135 to 372 (238 residues), 215.7 bits, see alignment E=4.4e-68 PF02405: MlaE" amino acids 161 to 369 (209 residues), 225.1 bits, see alignment E=3.8e-71

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to bpy:Bphyt_0491)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SWX2 at UniProt or InterPro

Protein Sequence (377 amino acids)

>BPHYT_RS02380 ABC transporter permease (Burkholderia phytofirmans PsJN)
MNYDTPPGLEVAAGSQGKIVRLSGQWTALALARDRATGHVIPLLRSLVGAEGIGQWDLSR
IDRMDHVGGQALWRVWGHKMPPDTTLTDTQRDIFERIALLDTVREKAEPVIRFDPLTRLG
LAIFSFFEHLYGGVAMLGRVVLDLLAIARKPKITPWTEISANIYNAGTKALPITALVAFL
IGIVLSYLSAQQLRLFGANQYIVNILGLSVIRELGPVLAAILVAGRSGSAITAQIGVMRV
TEELDAMRVMGIPHGLRLILPRVVALGVAMPLLVMWTNIIALTGGALAAKIALGIDMSYF
ARALPGVVPVANLWIGLGKGVAFGMLIAIVGCHFGFRIKANSQSLGEGTTTSVVTSITIV
ILADAVFAILFQNVGLG