Protein Info for BPHYT_RS02105 in Burkholderia phytofirmans PsJN

Annotation: multidrug DMT transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 38 to 60 (23 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 154 to 173 (20 residues), see Phobius details amino acids 185 to 202 (18 residues), see Phobius details amino acids 214 to 234 (21 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details PF00892: EamA" amino acids 16 to 141 (126 residues), 46.9 bits, see alignment E=1.6e-16 amino acids 156 to 286 (131 residues), 63.7 bits, see alignment E=1e-21

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0435)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SWR6 at UniProt or InterPro

Protein Sequence (300 amino acids)

>BPHYT_RS02105 multidrug DMT transporter permease (Burkholderia phytofirmans PsJN)
MMASNEIRRGAAEMTMAMLMSGTIGWLVVSSQQSPFNVVFFRCIFGGATLALVCALLGLF
QRKLFSWKMLGLALLGGAAIVINWVLLFAAYSRASISMATAVYNTQPFMLVALGALVFRE
RISASTVAWLVIAFVGLVFVVKVEPAVLAVPGQYLVGVAYAVGAAAMYAVSSIITKRLKG
TPPHLIALIQVSLGVLMLAPFVRFDALPATGVQWLELVVLGIVNTGLMYVLLYGAIQKLP
TSMTGALSFIYPVVAIIVDRVAFGQTLAWIQVLGAVLILVAAAGVNLGWRIVPQKRLSST