Protein Info for BPHYT_RS02050 in Burkholderia phytofirmans PsJN

Updated annotation (from data): D-mannose isomerase (EC 5.3.1.7)
Rationale: Specifically important for: D-Mannose; D-Sorbitol; D-Fructose. Often annotated as N-acylglucosamine 2-epimerase, but phenotype on mannose is consistent with annotation as mannose isomerase. Its role on sorbitol (which is probably oxidized to sorbose or fructose by BPHYT_RS16120) or fructose is unclear - this might be a polar effect on fructokinase (BPHYT_RS02045), as there is a stronger phenotype for insertions with the antibiotic resistance marker in the non-coding orientation
Original annotation: N-acylglucosamine 2-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 PF07221: GlcNAc_2-epim" amino acids 49 to 403 (355 residues), 369 bits, see alignment E=1.4e-114

Best Hits

KEGG orthology group: None (inferred from 100% identity to bpy:Bphyt_0424)

Predicted SEED Role

"D-mannose isomerase (EC 5.3.1.7)" in subsystem Mannose Metabolism (EC 5.3.1.7)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2SWQ5 at UniProt or InterPro

Protein Sequence (427 amino acids)

>BPHYT_RS02050 D-mannose isomerase (EC 5.3.1.7) (Burkholderia phytofirmans PsJN)
MTQSDPLHPANGAAAAPPVESFRSRDFLLSHVQDTLRFYAPNVFDPSGGFFHFFRDDGSV
YDKTTRHLVSSCRYVFNYAMAYRQFGDPQHLEYARHGLRFLREAHWDAQHEGYDWEIEWR
DGKKRTLDATRHCYGLAFVLLAYSHAAMAGIEEAKPMIGATFELMEHRFWDAAAGLYADE
ASPDWRVSSYRGQNANMHTTEALLAAHEATRHLVYLDRAERVASNITLRQAKLSQGLVWE
HFHADWSVDWHYNEEDSSNIFRPWGFQPGHQTEWAKLLLILERFRPLPWLLPRAIELFDA
AMAHAWDEDHGGLYYGFGPDGTVCDHDKYFWVQAETFATAALLGKRTGNERFWDWYDEIW
RYSWAHFVDHEYGAWYRILTCDNRKYSDEKSPAGKTDYHTMGACYEVLAHALPDGAAAAP
ESAEQTK