Protein Info for BPHYT_RS01825 in Burkholderia phytofirmans PsJN

Annotation: sugar ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details PF00532: Peripla_BP_1" amino acids 52 to 268 (217 residues), 64.5 bits, see alignment E=1.7e-21 PF13407: Peripla_BP_4" amino acids 53 to 314 (262 residues), 190.5 bits, see alignment E=6.3e-60 PF13377: Peripla_BP_3" amino acids 161 to 276 (116 residues), 35.9 bits, see alignment E=1.2e-12

Best Hits

KEGG orthology group: K10439, ribose transport system substrate-binding protein (inferred from 100% identity to bpy:Bphyt_0381)

Predicted SEED Role

"Ribose ABC transporter, periplasmic ribose-binding protein RbsB (TC 3.A.1.2.1)" in subsystem Bacterial Chemotaxis (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See B2T1S7 at UniProt or InterPro

Protein Sequence (339 amino acids)

>BPHYT_RS01825 sugar ABC transporter substrate-binding protein (Burkholderia phytofirmans PsJN)
MASLNTQSRRHVRKQQIRPLAGSLLALAIGFGVATAHADDALPKLASKTPLKVGFAQTES
NNPWRLAETKSFKDIAAKCGWQLVMTDANSSNSKQVSDIQNMIAQHVDLLVFPPREEKPL
APVVLQAKKAGIPVILVDRDVDQSVAKAGRDYITFIGSDFIDQGHRAADWLVKATGGKAK
IIELEGTTGASAANDRKKGFDEIIAKNPGMTIIASQSGDFARDKGRQVMETLLQAHPDVT
AVYAHNDEMALGAIAAIKAAGKQPGKDIQIVTIDGTKGGMDAIAAGELGASVQSSPFFGP
LACDVAQRYAKGEKIPTWVKVSDKFYDKSNVQQNMQYGY